PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf04122g06001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HSF
Protein Properties Length: 362aa    MW: 41911.8 Da    PI: 4.7179
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf04122g06001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind26.71.5e-0871108239
                               HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHH CS
              HSF_DNA-bind   2 Flkklyeiledeelkeliswsengnsfvvldeeefakk 39 
                               F+ k+ye+l d +++ lisw+ ng+sf+++d ++fa +
  Niben101Scf04122g06001.1  71 FVLKIYEMLADIQFNPLISWNGNGTSFIIHDCHKFAAE 108
                               9**********************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.105.6E-865108IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004157.7E-1367139IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467857.62E-1468139IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004472.8E-571109IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MTNDIGELLE EWYEDKGLED VQIDISMLEN DDYQGENTRN EGFHGSATGA HQHGFRVRNS  60
RRNLQKRACP FVLKIYEMLA DIQFNPLISW NGNGTSFIIH DCHKFAAEGF RKISWDKFEF  120
QHEYFQRGKG QWLKNIKRKG SKKSDMNQQP QEQGIVETVA VTMEKEIEEI REEQNAMREE  180
IIMLNQQLDI LEKEMEDTTK QARNHVSSKK AKILKYLLGP LFECIGEVAS SEVAQRLEEE  240
EKQGDEIEDG VENRGEKRKK QVEEELQGKN EGSKKTAAAG VSDFKSDSYL RKMLMDEMDM  300
NNLAQEQPDN FLESEEQAEG PSFWVDYVEK LDHKPILSGS QENHTANLFH VCALLNYNFI  360
KS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009790212.10.0PREDICTED: heat stress transcription factor A-7b-like
TrEMBLM1DNE41e-123M1DNE4_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000917901e-123(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA140991213
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G03720.11e-13heat shock transcription factor A3